Dundee Michigan Handyman
Find a trusted, reliable, honest, and hard working handyman for the Dundee, Michigan area.
handymanservicesindundeemi.info is not currently ranked anywhere. handymanservicesindundeemi.info was launched at March 1, 2015 and is 9 years and 97 days. It reaches roughly 30 users and delivers about 30 pageviews each month. Its estimated monthly revenue is $0.00. We estimate the value of handymanservicesindundeemi.info to be around $10.00. The domain handymanservicesindundeemi.info uses a Open TLD suffix and its server(s) are located in United States with the IP number 50.63.202.10. handymanservicesindundeemi.info is not listed on Dmoz.
Webmaster and SEO Tools
SEO Tools > Keyword Density Check
CloseWorth & Traffic Estimate of handymanservicesindundeemi.info
Estimated numbers for handymanservicesindundeemi.info - Niche: General - Average CPM: $2.80 CPM or eCPM: Effective Cost per 1000 impressions.For publishers it means average earnings for each 1k impressions.
Example: A website with a $3 CPM and 10000 impressions/pageviews a day is making on average $30 dollars a day.
Daily
Monthly
Yearly
Website Worth: $10.00
Daily Pageviews: 1
Daily Visitors: 1
Daily Ads Revenue: $0.00
Daily Pageviews: 1
Daily Visitors: 1
Daily Ads Revenue: $0.00
Website Worth: $10.00
Monthly Pageviews: 30
Monthly Visitors: 30
Monthly Ads Revenue: $0.00
Monthly Pageviews: 30
Monthly Visitors: 30
Monthly Ads Revenue: $0.00
Website Worth: $10.00
Yearly Pageviews: 365
Yearly Visitors: 365
Yearly Ads Revenue: $0.00
Yearly Pageviews: 365
Yearly Visitors: 365
Yearly Ads Revenue: $0.00
Choose a specific category/niche The value and earnings of a website just like a physical company also depends on the market it's focusing.
A Humor blog for example usually have low value for potential advertisers while a Finance one have a higher value since it usually has more visitors willing to buy expensive services/products and this consequently affects a website average earnings per visitors so as market worth.
A Humor blog for example usually have low value for potential advertisers while a Finance one have a higher value since it usually has more visitors willing to buy expensive services/products and this consequently affects a website average earnings per visitors so as market worth.
Automobile
$4.30
Average High priced niches
$8.00
Average Low priced niches
$2.00
B2B
$8.00
Banking and Finance
$12.00
Books & Online content
$2.00
Consumer durables
$3.00
Dating
$3.50
Education
$9.00
Entertainment
$1.00
Fashion and Clothing
$1.50
Fitness
$6.00
Food
$4.00
Gaming
$1.50
General
$2.80
Hotels and Travel
$3.50
IT hardware
$6.00
Jobs
$2.50
Legal
$15.00
Machinery or equipment
$3.00
Medical treatment
$8.00
Medicines
$4.00
Miracle drugs or vitamins
$3.50
Music
$1.00
News Portals
$10.00
Random blogs or content
$1.00
Real Estate
$7.20
Religion
$1.70
Science
$4.50
Shopping Portals
$2.50
Social networks
$0.70
Sports
$2.00
Technology
$8.50
Webmaster & Web Hosting
$12.00
Main Information of handymanservicesindundeemi.info
- Information of handymanservicesindundeemi.info
- Alexa Rank:Not ranked The Alexa rank is a measure of handymanservicesindundeemi.info's popularity.
The lower the rank is, the more popular the website is. This rank is calculated using a combination of average daily visitors and pageviews from handymanservicesindundeemi.info over the last 3 months.
Google.com ranks #1 for example. - Quantcast Rank:Not ranked/Not available The Quantcast rank is a measure of handymanservicesindundeemi.info's popularity.
The lower the rank is, the more popular the website is. This rank is calculated using a combination of average daily visitors and pageviews from handymanservicesindundeemi.info over the last 3 months.
Google.com ranks #1 for example. - Google Pagerank:Not ranked/Not available Google PageRank reflects the importance of web pages by considering more than 500 million variables and 2 billion terms. Pages that Google search engine believes are important receive a higher PageRank and are more likely to appear at the top of the search results.
PageRank also considers the importance of each page that casts a vote, as votes from some pages are considered to have greater value, thereby giving the linked page a greater value. - IP Address:50.63.202.10 IP Addresses are similar to physical addresses. It's a number that represents the identification and location of a website. Every computer has an IP address. - IP Tracing
- Site Age:9 years and 97 days
- Created:2015-03-01
- Expires:Not available.
- Updated:Not available.
- Owner:Thomas Mills
- ICANN Registrar:Afilias Global Registry Services This shows the company who handled the registration of this domain.
- Hosted in:United States
- Domain Suffix:Open TLD A domain suffix is the last part of a domain name and is often referred to as a "top-level domain" or TLD.
.COM is the most popular and it represents Commercial websites.
DNS Records of handymanservicesindundeemi.info
Name Servers of handymanservicesindundeemi.info
ns51.domaincontrol.com
ns52.domaincontrol.com
Header Info of handymanservicesindundeemi.info
Search Engine & Internet Presense of handymanservicesindundeemi.info
A website with a large amount of indexed pages in search engines is more likely to have tons of visits.If you are buying handymanservicesindundeemi.info or it is your competitor checking how many pages indexed it has is vital.
If handymanservicesindundeemi.info has no pages indexed it means it's too new, is banned or suffered a penalty.
- Internet Presense of handymanservicesindundeemi.info
- Backlinks: Not available for this website.
- Google Indexed Pages:View This represents how many pages from handymanservicesindundeemi.info are currently visible to the public on Google search engine.
- Yahoo Indexed Pages:View This represents how many pages from handymanservicesindundeemi.info are currently visible to the public on Yahoo search engine.
- Bing Indexed Pages:View This represents how many pages from handymanservicesindundeemi.info are currently visible to the public on Bing search engine.
- Dmoz Listing:No
- Dmoz Title:None
- Dmoz Description:None
- Web Archive:handymanservicesindundeemi.info (in the past).
Useful links for Website Owners
This website seems not to be very popular. If you are the owner of it these links might help you to promote it and increase its presense on the internet.Submit it to Google - Submit it to Bing/Yahoo
Statistical Graphics of handymanservicesindundeemi.info
Select an option below to analyse several graphic statistics.Compare this website to:
Period:
IP Tracing of handymanservicesindundeemi.info
- handymanservicesindundeemi.info is hosted by GoDaddy.com in Scottsdale, Arizona.
- Country:United States
- City:Scottsdale
- Region:Arizona
- Latitude:33.6119
- Longitude:-111.8906
- ASNum:AS26496 GoDaddy.com, LLC
- ISP:GoDaddy.com
- Organization:GoDaddy.com
- Postcode:85260
Similar Domain Names of handymanservicesindundeemi.info
handymanservicesindundemi.info, bandymanservicesindundeemi.info, gandymanservicesindundeemi.info, tandymanservicesindundeemi.info, yandymanservicesindundeemi.info, uandymanservicesindundeemi.info, jandymanservicesindundeemi.info, mandymanservicesindundeemi.info, nandymanservicesindundeemi.info, hqndymanservicesindundeemi.info, hwndymanservicesindundeemi.info, hzndymanservicesindundeemi.info, hxndymanservicesindundeemi.info, habdymanservicesindundeemi.info, hagdymanservicesindundeemi.info, hahdymanservicesindundeemi.info, hajdymanservicesindundeemi.info, hamdymanservicesindundeemi.info, hanxymanservicesindundeemi.info, hansymanservicesindundeemi.info, hanwymanservicesindundeemi.info, haneymanservicesindundeemi.info, hanrymanservicesindundeemi.info, hanfymanservicesindundeemi.info, hanvymanservicesindundeemi.info, hancymanservicesindundeemi.info, handtmanservicesindundeemi.info, handgmanservicesindundeemi.info, handhmanservicesindundeemi.info, handjmanservicesindundeemi.info, handumanservicesindundeemi.info, handynanservicesindundeemi.info, handyhanservicesindundeemi.info, handyjanservicesindundeemi.info, handykanservicesindundeemi.info, handylanservicesindundeemi.info, handymqnservicesindundeemi.info, handymwnservicesindundeemi.info, handymznservicesindundeemi.info, handymxnservicesindundeemi.info, handymabservicesindundeemi.info, handymagservicesindundeemi.info, handymahservicesindundeemi.info, handymajservicesindundeemi.info, handymamservicesindundeemi.info, handymanqervicesindundeemi.info, handymanwervicesindundeemi.info, handymaneervicesindundeemi.info, handymanzervicesindundeemi.info, handymanxervicesindundeemi.info, handymancervicesindundeemi.info, handymanswrvicesindundeemi.info, handymanssrvicesindundeemi.info, handymansdrvicesindundeemi.info, handymansfrvicesindundeemi.info, handymansrrvicesindundeemi.info, handymanseevicesindundeemi.info, handymansedvicesindundeemi.info, handymansefvicesindundeemi.info, handymansegvicesindundeemi.info, handymansetvicesindundeemi.info, handymansericesindundeemi.info, handymansercicesindundeemi.info, handymanserdicesindundeemi.info, handymanserficesindundeemi.info, handymansergicesindundeemi.info, handymanserbicesindundeemi.info, handymanservucesindundeemi.info, handymanservjcesindundeemi.info, handymanservkcesindundeemi.info, handymanservlcesindundeemi.info, handymanservocesindundeemi.info, handymanservixesindundeemi.info, handymanservisesindundeemi.info, handymanservidesindundeemi.info, handymanservifesindundeemi.info, handymanservivesindundeemi.info, handymanservicwsindundeemi.info, handymanservicssindundeemi.info, handymanservicdsindundeemi.info, handymanservicfsindundeemi.info, handymanservicrsindundeemi.info, handymanserviceqindundeemi.info, handymanservicewindundeemi.info, handymanserviceeindundeemi.info, handymanservicezindundeemi.info, handymanservicexindundeemi.info, handymanservicecindundeemi.info, handymanservicesundundeemi.info, handymanservicesjndundeemi.info, handymanserviceskndundeemi.info, handymanserviceslndundeemi.info, handymanservicesondundeemi.info, handymanservicesibdundeemi.info, handymanservicesigdundeemi.info, handymanservicesihdundeemi.info, handymanservicesijdundeemi.info, handymanservicesimdundeemi.info, handymanservicesinxundeemi.info, handymanservicesinsundeemi.info, handymanservicesinwundeemi.info, handymanservicesineundeemi.info, handymanservicesinrundeemi.info, handymanservicesinfundeemi.info, handymanservicesinvundeemi.info, handymanservicesincundeemi.info, handymanservicesindyndeemi.info, handymanservicesindhndeemi.info, handymanservicesindjndeemi.info, handymanservicesindkndeemi.info, handymanservicesindindeemi.info, handymanservicesindubdeemi.info, handymanservicesindugdeemi.info, handymanservicesinduhdeemi.info, handymanservicesindujdeemi.info, handymanservicesindumdeemi.info, handymanservicesindunxeemi.info, handymanservicesindunseemi.info, handymanservicesindunweemi.info, handymanservicesinduneeemi.info, handymanservicesindunreemi.info, handymanservicesindunfeemi.info, handymanservicesindunveemi.info, handymanservicesindunceemi.info, handymanservicesindundwemi.info, handymanservicesindundsemi.info, handymanservicesindunddemi.info, handymanservicesindundfemi.info, handymanservicesindundremi.info, handymanservicesindundewmi.info, handymanservicesindundesmi.info, handymanservicesindundedmi.info, handymanservicesindundefmi.info, handymanservicesindundermi.info, handymanservicesindundeeni.info, handymanservicesindundeehi.info, handymanservicesindundeeji.info, handymanservicesindundeeki.info, handymanservicesindundeeli.info, handymanservicesindundeemu.info, handymanservicesindundeemj.info, handymanservicesindundeemk.info, handymanservicesindundeeml.info, handymanservicesindundeemo.info,Whois Record of handymanservicesindundeemi.info
Domain Name:HANDYMANSERVICESINDUNDEEMI.INFO
Domain ID: D54319058-LRMS
Creation Date: 2015-01-03T20:57:32Z
Updated Date: 2015-01-03T20:57:33Z
Registry Expiry Date: 2016-01-03T20:57:32Z
Sponsoring Registrar:GoDaddy.com, LLC (R171-LRMS)
Sponsoring Registrar IANA ID: 146
WHOIS Server:
Referral URL:
Domain Status: clientDeleteProhibited
Domain Status: clientRenewProhibited
Domain Status: clientTransferProhibited
Domain Status: clientUpdateProhibited
Domain Status: serverTransferProhibited
Domain Status: addPeriod
Registrant ID:CR184402389
Registrant Name:Thomas Mills
Registrant Organization:
Registrant Street: 25 Oakridge East
Registrant City:Monroe
Registrant State/Province:Michigan
Registrant Postal Code:48161
Registrant Country:US
Registrant Phone:+1.7346934689
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email:[Spam Protected Email]
Admin ID:CR184402391
Admin Name:Thomas Mills
Admin Organization:
Admin Street: 25 Oakridge East
Admin City:Monroe
Admin State/Province:Michigan
Admin Postal Code:48161
Admin Country:US
Admin Phone:+1.7346934689
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email:[Spam Protected Email]
Billing ID:CR184402392
Billing Name:Thomas Mills
Billing Organization:
Billing Street: 25 Oakridge East
Billing City:Monroe
Billing State/Province:Michigan
Billing Postal Code:48161
Billing Country:US
Billing Phone:+1.7346934689
Billing Phone Ext:
Billing Fax:
Billing Fax Ext:
Billing Email:[Spam Protected Email]
Tech ID:CR184402390
Tech Name:Thomas Mills
Tech Organization:
Tech Street: 25 Oakridge East
Tech City:Monroe
Tech State/Province:Michigan
Tech Postal Code:48161
Tech Country:US
Tech Phone:+1.7346934689
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email:[Spam Protected Email]
Name Server:NS51.DOMAINCONTROL.COM
Name Server:NS52.DOMAINCONTROL.COM
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
DNSSEC:Unsigned
Access to AFILIAS WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the Afilias registry database. The data in this record is provided by Afilias Limited for informational purposes only, and Afilias does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to(a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. Afilias reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.
Domain ID: D54319058-LRMS
Creation Date: 2015-01-03T20:57:32Z
Updated Date: 2015-01-03T20:57:33Z
Registry Expiry Date: 2016-01-03T20:57:32Z
Sponsoring Registrar:GoDaddy.com, LLC (R171-LRMS)
Sponsoring Registrar IANA ID: 146
WHOIS Server:
Referral URL:
Domain Status: clientDeleteProhibited
Domain Status: clientRenewProhibited
Domain Status: clientTransferProhibited
Domain Status: clientUpdateProhibited
Domain Status: serverTransferProhibited
Domain Status: addPeriod
Registrant ID:CR184402389
Registrant Name:Thomas Mills
Registrant Organization:
Registrant Street: 25 Oakridge East
Registrant City:Monroe
Registrant State/Province:Michigan
Registrant Postal Code:48161
Registrant Country:US
Registrant Phone:+1.7346934689
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email:[Spam Protected Email]
Admin ID:CR184402391
Admin Name:Thomas Mills
Admin Organization:
Admin Street: 25 Oakridge East
Admin City:Monroe
Admin State/Province:Michigan
Admin Postal Code:48161
Admin Country:US
Admin Phone:+1.7346934689
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email:[Spam Protected Email]
Billing ID:CR184402392
Billing Name:Thomas Mills
Billing Organization:
Billing Street: 25 Oakridge East
Billing City:Monroe
Billing State/Province:Michigan
Billing Postal Code:48161
Billing Country:US
Billing Phone:+1.7346934689
Billing Phone Ext:
Billing Fax:
Billing Fax Ext:
Billing Email:[Spam Protected Email]
Tech ID:CR184402390
Tech Name:Thomas Mills
Tech Organization:
Tech Street: 25 Oakridge East
Tech City:Monroe
Tech State/Province:Michigan
Tech Postal Code:48161
Tech Country:US
Tech Phone:+1.7346934689
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email:[Spam Protected Email]
Name Server:NS51.DOMAINCONTROL.COM
Name Server:NS52.DOMAINCONTROL.COM
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
DNSSEC:Unsigned
Access to AFILIAS WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the Afilias registry database. The data in this record is provided by Afilias Limited for informational purposes only, and Afilias does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to(a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. Afilias reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.